Lineage for d2cz7a1 (2cz7 A:9-203)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735651Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 735652Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (1 family) (S)
    duplication: contains two structural repeats
  5. 735653Family d.149.1.1: Nitrile hydratase alpha chain [56210] (2 proteins)
  6. 735663Protein Iron-containing nitrile hydratase [56211] (1 species)
  7. 735664Species Rhodococcus erythropolis [TaxId:1833] [56212] (7 PDB entries)
    also Rhodococcus sp. R312
  8. 735669Domain d2cz7a1: 2cz7 A:9-203 [131042]
    Other proteins in same PDB: d2cz7b1
    automatically matched to d2ahja_
    complexed with fe, mg, no

Details for d2cz7a1

PDB Entry: 2cz7 (more details), 1.8 Å

PDB Description: Fe-type NHase photo-activated for 75min at 105K
PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOP Domain Sequences for d2cz7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cz7a1 d.149.1.1 (A:9-203) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqv

SCOP Domain Coordinates for d2cz7a1:

Click to download the PDB-style file with coordinates for d2cz7a1.
(The format of our PDB-style files is described here.)

Timeline for d2cz7a1: