Lineage for d2cz6a_ (2cz6 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594098Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 2594099Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 2594100Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 2594120Protein automated matches [190256] (6 species)
    not a true protein
  7. 2594153Species Rhodococcus erythropolis [TaxId:1833] [187042] (24 PDB entries)
  8. 2594163Domain d2cz6a_: 2cz6 A: [131040]
    Other proteins in same PDB: d2cz6b_
    automated match to d2ahja_
    complexed with cyi, fe, mg, no

Details for d2cz6a_

PDB Entry: 2cz6 (more details), 1.5 Å

PDB Description: Complex of Inactive Fe-type NHase with Cyclohexyl isocyanide
PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOPe Domain Sequences for d2cz6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cz6a_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]}
enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqvpt

SCOPe Domain Coordinates for d2cz6a_:

Click to download the PDB-style file with coordinates for d2cz6a_.
(The format of our PDB-style files is described here.)

Timeline for d2cz6a_: