Lineage for d2cz6a1 (2cz6 A:9-203)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875445Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 875446Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (1 family) (S)
    duplication: contains two structural repeats
  5. 875447Family d.149.1.1: Nitrile hydratase alpha chain [56210] (2 proteins)
  6. 875457Protein Iron-containing nitrile hydratase [56211] (1 species)
  7. 875458Species Rhodococcus erythropolis [TaxId:1833] [56212] (9 PDB entries)
    also Rhodococcus sp. R312
  8. 875461Domain d2cz6a1: 2cz6 A:9-203 [131040]
    Other proteins in same PDB: d2cz6b1
    automatically matched to d2ahja_
    complexed with cyi, fe, mg, no

Details for d2cz6a1

PDB Entry: 2cz6 (more details), 1.5 Å

PDB Description: Complex of Inactive Fe-type NHase with Cyclohexyl isocyanide
PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOP Domain Sequences for d2cz6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cz6a1 d.149.1.1 (A:9-203) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqv

SCOP Domain Coordinates for d2cz6a1:

Click to download the PDB-style file with coordinates for d2cz6a1.
(The format of our PDB-style files is described here.)

Timeline for d2cz6a1: