![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily) 4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets |
![]() | Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) ![]() duplication: contains two structural repeats |
![]() | Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins) automatically mapped to Pfam PF02979 |
![]() | Protein automated matches [190256] (6 species) not a true protein |
![]() | Species Rhodococcus erythropolis [TaxId:1833] [187042] (24 PDB entries) |
![]() | Domain d2cz6a_: 2cz6 A: [131040] Other proteins in same PDB: d2cz6b_ automated match to d2ahja_ complexed with cyi, fe, mg, no |
PDB Entry: 2cz6 (more details), 1.5 Å
SCOPe Domain Sequences for d2cz6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cz6a_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]} enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe ivtkdcligvaipqvpt
Timeline for d2cz6a_: