SCOP 1.73: Domain d2cz4c1: 2cz4 C:1-100

Lineage for d2cz4c1 (2cz4 C:1-100)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (4 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (3 proteins)

6. Protein Hypothetical protein TTHA0516 [143281] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143282] (1 PDB entry)

8. Domain d2cz4c1: 2cz4 C:1-100 [131037]
   automatically matched to 2CZ4 A:1-100
   complexed with act, cl

Details for d2cz4c1

PDB Entry: 2cz4, 1.93 Å

PDB Description: Crystal structure of a putative PII-like signaling protein (TTHA0516) from Thermus thermophilus HB8

PDB Compounds: (C:) hypothetical protein TTHA0516

SCOP Domain Sequences for d2cz4c1:

Sequence, based on SEQRES records:

>d2cz4c1 d.58.5.1 (C:1-100) Hypothetical protein TTHA0516 {Thermus thermophilus [TaxId: 274]}
mdlvplklvtivaesllekrlveevkrlgakgytitpargegsrgirsvdwegqnirlet
ivseevalrilqrlqeeyfphyaviayvenvwvvrgekyv

Sequence, based on observed residues (ATOM records):

>d2cz4c1 d.58.5.1 (C:1-100) Hypothetical protein TTHA0516 {Thermus thermophilus [TaxId: 274]}
mdlvplklvtivaesllekrlveevkrlgakgytitpargegsegqnirletivseeval
rilqrlqeeyfphyaviayvenvwvvrgekyv

Timeline for d2cz4c1:

• d2cz4c1 is new in SCOP 1.73
  
• d2cz4c1 appears in SCOP 1.75
  
• d2cz4c1 appears in the current release, SCOPe 2.08, called d2cz4c2