Lineage for d2cz1b1 (2cz1 B:1-211)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665462Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) (S)
  5. 665485Family b.34.4.4: Nitrile hydratase beta chain [50101] (2 proteins)
    contains irregular array of helices in the N-terminal extension
  6. 665495Protein Iron-containing nitrile hydratase [50102] (1 species)
  7. 665496Species Rhodococcus erythropolis [TaxId:1833] [50103] (8 PDB entries)
    also Rhodococcus sp. R312
  8. 665497Domain d2cz1b1: 2cz1 B:1-211 [131034]
    Other proteins in same PDB: d2cz1a1
    automatically matched to d2ahjd_
    complexed with bua, fe, mg

Details for d2cz1b1

PDB Entry: 2cz1 (more details), 1.39 Å

PDB Description: photo-activation state of Fe-type NHase with n-BA in anaerobic condition
PDB Compounds: (B:) Nitrile hydratase subunit beta

SCOP Domain Sequences for d2cz1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cz1b1 b.34.4.4 (B:1-211) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepa

SCOP Domain Coordinates for d2cz1b1:

Click to download the PDB-style file with coordinates for d2cz1b1.
(The format of our PDB-style files is described here.)

Timeline for d2cz1b1: