Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) |
Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins) contains irregular array of helices in the N-terminal extension automatically mapped to Pfam PF02211 |
Protein Iron-containing nitrile hydratase [50102] (1 species) |
Species Rhodococcus erythropolis [TaxId:1833] [50103] (24 PDB entries) also Rhodococcus sp. R312 |
Domain d2cz0b_: 2cz0 B: [131032] Other proteins in same PDB: d2cz0a1 automated match to d2ahjd_ complexed with bua, fe |
PDB Entry: 2cz0 (more details), 1.5 Å
SCOPe Domain Sequences for d2cz0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cz0b_ b.34.4.4 (B:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]} mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty hvkfaaeelfgsdtdggsvvvdlfegylepa
Timeline for d2cz0b_: