![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) ![]() |
![]() | Family b.34.4.4: Nitrile hydratase beta chain [50101] (2 proteins) contains irregular array of helices in the N-terminal extension |
![]() | Protein Iron-containing nitrile hydratase [50102] (1 species) |
![]() | Species Rhodococcus erythropolis [TaxId:1833] [50103] (16 PDB entries) also Rhodococcus sp. R312 |
![]() | Domain d2cz0b1: 2cz0 B:1-211 [131032] Other proteins in same PDB: d2cz0a1 automatically matched to d2ahjd_ complexed with bua, fe |
PDB Entry: 2cz0 (more details), 1.5 Å
SCOP Domain Sequences for d2cz0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cz0b1 b.34.4.4 (B:1-211) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]} mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty hvkfaaeelfgsdtdggsvvvdlfegylepa
Timeline for d2cz0b1: