Lineage for d2cz0b1 (2cz0 B:1-211)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796525Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) (S)
  5. 796556Family b.34.4.4: Nitrile hydratase beta chain [50101] (2 proteins)
    contains irregular array of helices in the N-terminal extension
  6. 796566Protein Iron-containing nitrile hydratase [50102] (1 species)
  7. 796567Species Rhodococcus erythropolis [TaxId:1833] [50103] (16 PDB entries)
    also Rhodococcus sp. R312
  8. 796579Domain d2cz0b1: 2cz0 B:1-211 [131032]
    Other proteins in same PDB: d2cz0a1
    automatically matched to d2ahjd_
    complexed with bua, fe

Details for d2cz0b1

PDB Entry: 2cz0 (more details), 1.5 Å

PDB Description: photo-activation state of Fe-type NHase in aerobic condition
PDB Compounds: (B:) Nitrile hydratase subunit beta

SCOP Domain Sequences for d2cz0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cz0b1 b.34.4.4 (B:1-211) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepa

SCOP Domain Coordinates for d2cz0b1:

Click to download the PDB-style file with coordinates for d2cz0b1.
(The format of our PDB-style files is described here.)

Timeline for d2cz0b1: