Lineage for d2cyza1 (2cyz A:8-203)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875445Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 875446Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (1 family) (S)
    duplication: contains two structural repeats
  5. 875447Family d.149.1.1: Nitrile hydratase alpha chain [56210] (2 proteins)
  6. 875457Protein Iron-containing nitrile hydratase [56211] (1 species)
  7. 875458Species Rhodococcus erythropolis [TaxId:1833] [56212] (9 PDB entries)
    also Rhodococcus sp. R312
  8. 875462Domain d2cyza1: 2cyz A:8-203 [131030]
    Other proteins in same PDB: d2cyzb1
    automatically matched to d2ahja_
    complexed with fe, mg

Details for d2cyza1

PDB Entry: 2cyz (more details), 1.55 Å

PDB Description: photo-activation state of Fe-type NHase in anaerobic condition
PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOP Domain Sequences for d2cyza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cyza1 d.149.1.1 (A:8-203) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
tenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdp
efrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwy
ksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlq
eivtkdcligvaipqv

SCOP Domain Coordinates for d2cyza1:

Click to download the PDB-style file with coordinates for d2cyza1.
(The format of our PDB-style files is described here.)

Timeline for d2cyza1: