SCOPe 2.05: Domain d2cyja1: 2cyj A:1-118

Lineage for d2cyja1 (2cyj A:1-118)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.103: MTH938-like [64075] (1 superfamily)
   core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest

4. Superfamily c.103.1: MTH938-like [64076] (1 family)
   automatically mapped to Pfam PF04430

5. Family c.103.1.1: MTH938-like [64077] (5 proteins)

6. Protein Hypothetical protein PH1505 [142441] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [142442] (1 PDB entry)
   Uniprot O59174 1-118

8. Domain d2cyja1: 2cyj A:1-118 [131026]
   complexed with act, so4

Details for d2cyja1

PDB Entry: 2cyj, 1.5 Å

PDB Description: Crystal structure of conserved hypothetical protein PH1505 from Pyrococcus horikoshii OT3

PDB Compounds: (A:) hypothetical protein PH1505

SCOPe Domain Sequences for d2cyja1:

Sequence; same for both SEQRES and ATOM records:

>d2cyja1 c.103.1.1 (A:1-118) Hypothetical protein PH1505 {Pyrococcus horikoshii [TaxId: 53953]}
mkieevrfglvkidgkefdhdiviypsgrierrmkeiskkkhgtshkldpeelekylved
fdvllvgtgiygmlsllpeskklvedkeviekptkealklleelwgkkrilaiihvtc

Timeline for d2cyja1:

• d2cyja1 first appeared in SCOP 1.73
  
• d2cyja1 appears in SCOPe 2.04
  
• d2cyja1 appears in SCOPe 2.06
  
• d2cyja1 appears in the current release, SCOPe 2.08