Lineage for d2cyja1 (2cyj A:1-118)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919238Fold c.103: MTH938-like [64075] (1 superfamily)
    core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest
  4. 2919239Superfamily c.103.1: MTH938-like [64076] (1 family) (S)
    automatically mapped to Pfam PF04430
  5. 2919240Family c.103.1.1: MTH938-like [64077] (5 proteins)
  6. 2919248Protein Hypothetical protein PH1505 [142441] (1 species)
  7. 2919249Species Pyrococcus horikoshii [TaxId:53953] [142442] (1 PDB entry)
    Uniprot O59174 1-118
  8. 2919250Domain d2cyja1: 2cyj A:1-118 [131026]
    complexed with act, so4

Details for d2cyja1

PDB Entry: 2cyj (more details), 1.5 Å

PDB Description: Crystal structure of conserved hypothetical protein PH1505 from Pyrococcus horikoshii OT3
PDB Compounds: (A:) hypothetical protein PH1505

SCOPe Domain Sequences for d2cyja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cyja1 c.103.1.1 (A:1-118) Hypothetical protein PH1505 {Pyrococcus horikoshii [TaxId: 53953]}
mkieevrfglvkidgkefdhdiviypsgrierrmkeiskkkhgtshkldpeelekylved
fdvllvgtgiygmlsllpeskklvedkeviekptkealklleelwgkkrilaiihvtc

SCOPe Domain Coordinates for d2cyja1:

Click to download the PDB-style file with coordinates for d2cyja1.
(The format of our PDB-style files is described here.)

Timeline for d2cyja1: