![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.103: MTH938-like [64075] (1 superfamily) core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest |
![]() | Superfamily c.103.1: MTH938-like [64076] (1 family) ![]() automatically mapped to Pfam PF04430 |
![]() | Family c.103.1.1: MTH938-like [64077] (5 proteins) |
![]() | Protein Hypothetical protein PH1505 [142441] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [142442] (1 PDB entry) Uniprot O59174 1-118 |
![]() | Domain d2cyja1: 2cyj A:1-118 [131026] complexed with act, so4 |
PDB Entry: 2cyj (more details), 1.5 Å
SCOPe Domain Sequences for d2cyja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cyja1 c.103.1.1 (A:1-118) Hypothetical protein PH1505 {Pyrococcus horikoshii [TaxId: 53953]} mkieevrfglvkidgkefdhdiviypsgrierrmkeiskkkhgtshkldpeelekylved fdvllvgtgiygmlsllpeskklvedkeviekptkealklleelwgkkrilaiihvtc
Timeline for d2cyja1: