![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
![]() | Family d.38.1.1: 4HBT-like [54638] (19 proteins) Pfam PF03061 |
![]() | Protein Probable thioesterase TTHA1846 [143150] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [143151] (1 PDB entry) Uniprot Q5SH84 1-132 |
![]() | Domain d2cyec_: 2cye C: [131023] automated match to d2cyea1 complexed with coa, zn |
PDB Entry: 2cye (more details), 1.9 Å
SCOPe Domain Sequences for d2cyec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cyec_ d.38.1.1 (C:) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} megfpvrvrvdvrfrdldplghvnnavflsymelariryfqrispdwleeghfvvarmev dylrpillgdevfvgvrtvglgrsslrmehlvtangesaakglgvlvwleggrpaplpea ireriralegrpl
Timeline for d2cyec_: