Lineage for d2cyec_ (2cye C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409951Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1409952Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1409953Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 1410049Protein Probable thioesterase TTHA1846 [143150] (1 species)
  7. 1410050Species Thermus thermophilus [TaxId:274] [143151] (1 PDB entry)
    Uniprot Q5SH84 1-132
  8. 1410053Domain d2cyec_: 2cye C: [131023]
    automated match to d2cyea1
    complexed with coa, zn

Details for d2cyec_

PDB Entry: 2cye (more details), 1.9 Å

PDB Description: Crystal structure of Thioesterase complexed with coenzyme A and Zn from Thermus thermophilus HB8
PDB Compounds: (C:) Putative thioesterase

SCOPe Domain Sequences for d2cyec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cyec_ d.38.1.1 (C:) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]}
megfpvrvrvdvrfrdldplghvnnavflsymelariryfqrispdwleeghfvvarmev
dylrpillgdevfvgvrtvglgrsslrmehlvtangesaakglgvlvwleggrpaplpea
ireriralegrpl

SCOPe Domain Coordinates for d2cyec_:

Click to download the PDB-style file with coordinates for d2cyec_.
(The format of our PDB-style files is described here.)

Timeline for d2cyec_: