Lineage for d2cy9a1 (2cy9 A:13-139)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2511612Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2511613Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2511928Family d.38.1.5: PaaI/YdiI-like [89902] (15 protein domains)
  6. 2511971Protein Hypothetical protein Them2 [143179] (2 species)
  7. 2511978Species Mouse (Mus musculus) [TaxId:10090] [143180] (1 PDB entry)
    Uniprot Q9CQR4 13-139
  8. 2511979Domain d2cy9a1: 2cy9 A:13-139 [131019]
    Other proteins in same PDB: d2cy9b_

Details for d2cy9a1

PDB Entry: 2cy9 (more details), 2.72 Å

PDB Description: Crystal structure of thioesterase superfamily member2 from Mus musculus
PDB Compounds: (A:) Thioesterase superfamily member 2

SCOPe Domain Sequences for d2cy9a1:

Sequence, based on SEQRES records: (download)

>d2cy9a1 d.38.1.5 (A:13-139) Hypothetical protein Them2 {Mouse (Mus musculus) [TaxId: 10090]}
kvmfkvpgfdrvlekvtlvsaapeklicemkveeqhtnklgtlhggltatlvdsistmal
mctergapgvsvdmnitymspakigeeivitahilkqgktlafasvdltnkttgkliaqg
rhtkhlg

Sequence, based on observed residues (ATOM records): (download)

>d2cy9a1 d.38.1.5 (A:13-139) Hypothetical protein Them2 {Mouse (Mus musculus) [TaxId: 10090]}
kvmfkvpgfdvlekvtlvsaapeklicemkveeqhtnklgtlhggltatlvdsistmalm
ctpgvsvdmnitymspakigeeivitahilkqgktlafasvdltnkttgkliaqgrhtkh
lg

SCOPe Domain Coordinates for d2cy9a1:

Click to download the PDB-style file with coordinates for d2cy9a1.
(The format of our PDB-style files is described here.)

Timeline for d2cy9a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cy9b_