Lineage for d2cy5a_ (2cy5 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071257Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2071326Protein automated matches [190580] (4 species)
    not a true protein
  7. 2071337Species Mouse (Mus musculus) [TaxId:10090] [187584] (1 PDB entry)
  8. 2071338Domain d2cy5a_: 2cy5 A: [131018]
    automated match to d2cy4a1
    complexed with ca

Details for d2cy5a_

PDB Entry: 2cy5 (more details), 1.9 Å

PDB Description: Crystal structure of phosphotyrosine binding (PTB) domain of epidermal growth factor receptor pathway substrate-8 (EPS8) related protein 1 from Mus musculus (form-2 crystal)
PDB Compounds: (A:) epidermal growth factor receptor pathway substrate 8-like protein 1

SCOPe Domain Sequences for d2cy5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cy5a_ b.55.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
madvsqyhvnhlvtfclgeedgvhtvedasrklavmdsqgrvwaqemllrvspsqvtlld
pvskeelesypldaivrcdavmprgrsrsllllvcqeperaqpdvhffqglllgaelire
diqgalqnyr

SCOPe Domain Coordinates for d2cy5a_:

Click to download the PDB-style file with coordinates for d2cy5a_.
(The format of our PDB-style files is described here.)

Timeline for d2cy5a_: