Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins) Pfam PF00640 |
Protein automated matches [190580] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187584] (1 PDB entry) |
Domain d2cy5a_: 2cy5 A: [131018] automated match to d2cy4a1 complexed with ca |
PDB Entry: 2cy5 (more details), 1.9 Å
SCOPe Domain Sequences for d2cy5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cy5a_ b.55.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} madvsqyhvnhlvtfclgeedgvhtvedasrklavmdsqgrvwaqemllrvspsqvtlld pvskeelesypldaivrcdavmprgrsrsllllvcqeperaqpdvhffqglllgaelire diqgalqnyr
Timeline for d2cy5a_: