Lineage for d2cy4a1 (2cy4 A:31-159)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 673212Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (12 proteins)
    Pfam PF00640
  6. 673240Protein EPS8-like protein 1, EPS8L1 [141424] (1 species)
  7. 673241Species Mouse (Mus musculus) [TaxId:10090] [141425] (2 PDB entries)
  8. 673242Domain d2cy4a1: 2cy4 A:31-159 [131017]
    complexed with ca

Details for d2cy4a1

PDB Entry: 2cy4 (more details), 1.94 Å

PDB Description: Crystal structure of phosphotyrosine binding (PTB) domain of epidermal growth factor receptor pathway substrate-8 (EPS8) related protein 1 from Mus musculus (form-1 crystal)
PDB Compounds: (A:) epidermal growth factor receptor pathway substrate 8-like protein 1

SCOP Domain Sequences for d2cy4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cy4a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]}
advsqyhvnhlvtfclgeedgvhtvedasrklavmdsqgrvwaqemllrvspsqvtlldp
vskeelesypldaivrcdavmprgrsrsllllvcqeperaqpdvhffqglllgaelired
iqgalqnyr

SCOP Domain Coordinates for d2cy4a1:

Click to download the PDB-style file with coordinates for d2cy4a1.
(The format of our PDB-style files is described here.)

Timeline for d2cy4a1: