Lineage for d2cy4a1 (2cy4 A:31-159)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803365Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2803394Protein EPS8-like protein 1, EPS8L1 [141424] (1 species)
  7. 2803395Species Mouse (Mus musculus) [TaxId:10090] [141425] (1 PDB entry)
    Uniprot Q8R5F8 31-159
  8. 2803396Domain d2cy4a1: 2cy4 A:31-159 [131017]
    complexed with ca
    has additional insertions and/or extensions that are not grouped together

Details for d2cy4a1

PDB Entry: 2cy4 (more details), 1.94 Å

PDB Description: Crystal structure of phosphotyrosine binding (PTB) domain of epidermal growth factor receptor pathway substrate-8 (EPS8) related protein 1 from Mus musculus (form-1 crystal)
PDB Compounds: (A:) epidermal growth factor receptor pathway substrate 8-like protein 1

SCOPe Domain Sequences for d2cy4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cy4a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]}
advsqyhvnhlvtfclgeedgvhtvedasrklavmdsqgrvwaqemllrvspsqvtlldp
vskeelesypldaivrcdavmprgrsrsllllvcqeperaqpdvhffqglllgaelired
iqgalqnyr

SCOPe Domain Coordinates for d2cy4a1:

Click to download the PDB-style file with coordinates for d2cy4a1.
(The format of our PDB-style files is described here.)

Timeline for d2cy4a1: