Lineage for d2cxxc_ (2cxx C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988558Protein automated matches [190047] (13 species)
    not a true protein
  7. 988744Species Pyrococcus horikoshii [TaxId:70601] [187582] (1 PDB entry)
  8. 988746Domain d2cxxc_: 2cxx C: [131015]
    Other proteins in same PDB: d2cxxa1
    automated match to d2cxxa1
    complexed with gdp

Details for d2cxxc_

PDB Entry: 2cxx (more details), 1.7 Å

PDB Description: Crystal structure of a probable GTP-binding protein engB
PDB Compounds: (C:) Probable GTP-binding protein engB

SCOPe Domain Sequences for d2cxxc_:

Sequence, based on SEQRES records: (download)

>d2cxxc_ c.37.1.8 (C:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
atiifagrsnvgkstliyrltgkkvrrgkrpgvtrkiieiewknhkiidmpgfgfmmglp
kevqerikdeivhfiednaknidvavlvvdgkaapeiikrwekrgeipidvefyqflrel
diptivavnkldkiknvqevinflaekfevplseidkvfipisakfgdnierlknrifev
irer

Sequence, based on observed residues (ATOM records): (download)

>d2cxxc_ c.37.1.8 (C:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
atiifagrsnvgkstliyrltgkkvrgvtrkiieiewknhkiidmpgfgfmmglpkevqe
rikdeivhfiednaknidvavlvvdgkaapeiikrwekrgeipidvefyqflreldipti
vavnkldkiknvqevinflaekfevplseidkvfipisakfgdnierlknrifevirer

SCOPe Domain Coordinates for d2cxxc_:

Click to download the PDB-style file with coordinates for d2cxxc_.
(The format of our PDB-style files is described here.)

Timeline for d2cxxc_: