SCOPe 2.08: Domain d2cxxc_: 2cxx C:

Lineage for d2cxxc_ (2cxx C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [187582] (1 PDB entry)

8. Domain d2cxxc_: 2cxx C: [131015]
   Other proteins in same PDB: d2cxxa1
   automated match to d2cxxa1
   complexed with gdp

Details for d2cxxc_

PDB Entry: 2cxx, 1.7 Å

PDB Description: Crystal structure of a probable GTP-binding protein engB

PDB Compounds: (C:) Probable GTP-binding protein engB

SCOPe Domain Sequences for d2cxxc_:

Sequence, based on SEQRES records:

>d2cxxc_ c.37.1.8 (C:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
atiifagrsnvgkstliyrltgkkvrrgkrpgvtrkiieiewknhkiidmpgfgfmmglp
kevqerikdeivhfiednaknidvavlvvdgkaapeiikrwekrgeipidvefyqflrel
diptivavnkldkiknvqevinflaekfevplseidkvfipisakfgdnierlknrifev
irer

Sequence, based on observed residues (ATOM records):

>d2cxxc_ c.37.1.8 (C:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
atiifagrsnvgkstliyrltgkkvrgvtrkiieiewknhkiidmpgfgfmmglpkevqe
rikdeivhfiednaknidvavlvvdgkaapeiikrwekrgeipidvefyqflreldipti
vavnkldkiknvqevinflaekfevplseidkvfipisakfgdnierlknrifevirer

Timeline for d2cxxc_:

• d2cxxc_ first appeared in SCOP 1.73, called d2cxxc1
  
• d2cxxc_ appears in SCOPe 2.07