Lineage for d2cxxb_ (2cxx B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448880Protein automated matches [190047] (29 species)
    not a true protein
  7. 2449331Species Pyrococcus horikoshii OT3 [TaxId:70601] [187582] (1 PDB entry)
  8. 2449332Domain d2cxxb_: 2cxx B: [131014]
    Other proteins in same PDB: d2cxxa1
    automated match to d2cxxa1
    complexed with gdp

Details for d2cxxb_

PDB Entry: 2cxx (more details), 1.7 Å

PDB Description: Crystal structure of a probable GTP-binding protein engB
PDB Compounds: (B:) Probable GTP-binding protein engB

SCOPe Domain Sequences for d2cxxb_:

Sequence, based on SEQRES records: (download)

>d2cxxb_ c.37.1.8 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
atiifagrsnvgkstliyrltgkkvrrgkrpgvtrkiieiewknhkiidmpgfgfmmglp
kevqerikdeivhfiednaknidvavlvvdgkaapeiikrwekrgeipidvefyqflrel
diptivavnkldkiknvqevinflaekfevplseidkvfipisakfgdnierlknrifev
irer

Sequence, based on observed residues (ATOM records): (download)

>d2cxxb_ c.37.1.8 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
atiifagrsnvgkstliyrltgkkvrrkiieiewknhkiidmpgfgfmmglpkevqerik
deivhfiednaknidvavlvvdgkaapeiikrwekrgeipidvefyqflreldiptivav
nkldkiknvqevinflaekfevplseidkvfipisakfgdnierlknrifevirer

SCOPe Domain Coordinates for d2cxxb_:

Click to download the PDB-style file with coordinates for d2cxxb_.
(The format of our PDB-style files is described here.)

Timeline for d2cxxb_: