SCOP 1.75: Domain d2cxva1: 2cxv A:1-212

Lineage for d2cxva1 (2cxv A:1-212)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)

6. Protein 3C cysteine protease (picornain 3C) [50604] (4 species)

7. Species Human hepatitis A virus [TaxId:208726] [50606] (7 PDB entries)

8. Domain d2cxva1: 2cxv A:1-212 [131012]
   automatically matched to d1hava_
   complexed with bbl; mutant

Details for d2cxva1

PDB Entry: 2cxv, 1.4 Å

PDB Description: dual modes of modification of hepatitis a virus 3c protease by a serine-derived betalactone: selective crystallization and high- resolution structure of the his-102 adduct

PDB Compounds: (A:) Probable protein P3C

SCOP Domain Sequences for d2cxva1:

Sequence; same for both SEQRES and ATOM records:

>d2cxva1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]}
stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
rggtyysisagnvviqsldvgfqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
qsiqnailgihvaggnsilvaklvtqemfqni

Timeline for d2cxva1:

• d2cxva1 first appeared in SCOP 1.73
  
• d2cxva1 is called d2cxva_ in SCOPe 2.01
  
• d2cxva1 appears in the current release, SCOPe 2.08, called d2cxva_