Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins) |
Protein 3C cysteine protease (picornain 3C) [50604] (4 species) |
Species Human hepatitis A virus [TaxId:208726] [50606] (7 PDB entries) |
Domain d2cxva1: 2cxv A:1-212 [131012] automatically matched to d1hava_ complexed with bbl; mutant |
PDB Entry: 2cxv (more details), 1.4 Å
SCOP Domain Sequences for d2cxva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cxva1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn rggtyysisagnvviqsldvgfqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn qsiqnailgihvaggnsilvaklvtqemfqni
Timeline for d2cxva1: