Lineage for d2cxva1 (2cxv A:1-212)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 671623Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)
  6. 671628Protein 3C cysteine protease (picornain 3C) [50604] (3 species)
  7. 671629Species Human hepatitis A virus [TaxId:208726] [50606] (7 PDB entries)
  8. 671633Domain d2cxva1: 2cxv A:1-212 [131012]
    automatically matched to d1hava_
    complexed with bbl; mutant

Details for d2cxva1

PDB Entry: 2cxv (more details), 1.4 Å

PDB Description: dual modes of modification of hepatitis a virus 3c protease by a serine-derived betalactone: selective crystallization and high- resolution structure of the his-102 adduct
PDB Compounds: (A:) Probable protein P3C

SCOP Domain Sequences for d2cxva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cxva1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]}
stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
rggtyysisagnvviqsldvgfqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
qsiqnailgihvaggnsilvaklvtqemfqni

SCOP Domain Coordinates for d2cxva1:

Click to download the PDB-style file with coordinates for d2cxva1.
(The format of our PDB-style files is described here.)

Timeline for d2cxva1: