Lineage for d2cxva_ (2cxv A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797308Protein 3C cysteine protease (picornain 3C) [50604] (9 species)
  7. 2797338Species Human hepatitis a virus hu/northern africa/mbb/1978 [TaxId:12100] [186929] (2 PDB entries)
  8. 2797339Domain d2cxva_: 2cxv A: [131012]
    automated match to d1qa7b_
    complexed with bbl

Details for d2cxva_

PDB Entry: 2cxv (more details), 1.4 Å

PDB Description: dual modes of modification of hepatitis a virus 3c protease by a serine-derived betalactone: selective crystallization and high- resolution structure of the his-102 adduct
PDB Compounds: (A:) Probable protein P3C

SCOPe Domain Sequences for d2cxva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cxva_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human hepatitis a virus hu/northern africa/mbb/1978 [TaxId: 12100]}
stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
rggtyysisagnvviqsldvgfqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
qsiqnailgihvaggnsilvaklvtqemfqni

SCOPe Domain Coordinates for d2cxva_:

Click to download the PDB-style file with coordinates for d2cxva_.
(The format of our PDB-style files is described here.)

Timeline for d2cxva_: