![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
![]() | Protein 3C cysteine protease (picornain 3C) [50604] (9 species) |
![]() | Species Human hepatitis a virus hu/northern africa/mbb/1978 [TaxId:12100] [186929] (2 PDB entries) |
![]() | Domain d2cxva_: 2cxv A: [131012] automated match to d1qa7b_ complexed with bbl |
PDB Entry: 2cxv (more details), 1.4 Å
SCOPe Domain Sequences for d2cxva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cxva_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human hepatitis a virus hu/northern africa/mbb/1978 [TaxId: 12100]} stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn rggtyysisagnvviqsldvgfqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn qsiqnailgihvaggnsilvaklvtqemfqni
Timeline for d2cxva_: