SCOPe 2.01: Domain d2cxke_: 2cxk E:

Lineage for d2cxke_ (2cxk E:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein Calmodulin binding transcription activator 1 [141017] (1 species)
   this domain is in the middle of long protein chain

7. Species Human (Homo sapiens) [TaxId:9606] [141018] (1 PDB entry)
   Uniprot Q9Y6Y1 872-953

8. Domain d2cxke_: 2cxk E: [131010]
   automated match to d2cxka1
   complexed with so4

Details for d2cxke_

PDB Entry: 2cxk, 1.85 Å

PDB Description: Crystal structure of the TIG domain of human calmodulin-binding transcription activator 1 (CAMTA1)

PDB Compounds: (E:) calmodulin binding transcription activator 1

SCOPe Domain Sequences for d2cxke_:

Sequence; same for both SEQRES and ATOM records:

>d2cxke_ b.1.18.1 (E:) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]}
ssgmvtdyspewsypeggvkvlitgpwqeasnnysclfdqisvpasliqpgvlrcycpah
dtglvtlqvafnnqiisnsvvfeyks

Timeline for d2cxke_:

• d2cxke_ first appeared in SCOP 1.73, called d2cxke1
  
• d2cxke_ was called d2cxke1 in SCOP 1.75
  
• d2cxke_ appears in SCOPe 2.02
  
• d2cxke_ appears in the current release, SCOPe 2.08, called d2cxke2