![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (23 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins) subgroup of the larger IPT/TIG domain family |
![]() | Protein Calmodulin binding transcription activator 1 [141017] (1 species) this domain is in the middle of long protein chain |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141018] (1 PDB entry) Uniprot Q9Y6Y1 872-953 |
![]() | Domain d2cxke1: 2cxk E:872-953 [131010] automatically matched to 2CXK A:872-953 complexed with so4 |
PDB Entry: 2cxk (more details), 1.85 Å
SCOP Domain Sequences for d2cxke1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cxke1 b.1.18.1 (E:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} mvtdyspewsypeggvkvlitgpwqeasnnysclfdqisvpasliqpgvlrcycpahdtg lvtlqvafnnqiisnsvvfeyk
Timeline for d2cxke1:
![]() Domains from other chains: (mouse over for more information) d2cxka1, d2cxkb1, d2cxkc1, d2cxkd1 |