SCOP 1.73: Domain d2cxkd1: 2cxk D:872-953

Lineage for d2cxkd1 (2cxk D:872-953)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein Calmodulin binding transcription activator 1 [141017] (1 species)
   this domain is in the middle of long protein chain

7. Species Human (Homo sapiens) [TaxId:9606] [141018] (1 PDB entry)

8. Domain d2cxkd1: 2cxk D:872-953 [131009]
   automatically matched to 2CXK A:872-953
   complexed with so4

Details for d2cxkd1

PDB Entry: 2cxk, 1.85 Å

PDB Description: Crystal structure of the TIG domain of human calmodulin-binding transcription activator 1 (CAMTA1)

PDB Compounds: (D:) calmodulin binding transcription activator 1

SCOP Domain Sequences for d2cxkd1:

Sequence; same for both SEQRES and ATOM records:

>d2cxkd1 b.1.18.1 (D:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]}
mvtdyspewsypeggvkvlitgpwqeasnnysclfdqisvpasliqpgvlrcycpahdtg
lvtlqvafnnqiisnsvvfeyk

Timeline for d2cxkd1:

• d2cxkd1 is new in SCOP 1.73
  
• d2cxkd1 appears in SCOP 1.75
  
• d2cxkd1 appears in the current release, SCOPe 2.08, called d2cxkd2