Lineage for d2cxkc2 (2cxk C:872-953)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2038572Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 2038573Protein Calmodulin binding transcription activator 1 [141017] (1 species)
    this domain is in the middle of long protein chain
  7. 2038574Species Human (Homo sapiens) [TaxId:9606] [141018] (1 PDB entry)
    Uniprot Q9Y6Y1 872-953
  8. 2038577Domain d2cxkc2: 2cxk C:872-953 [131008]
    Other proteins in same PDB: d2cxka2, d2cxka3, d2cxkb3, d2cxkb4, d2cxkc3, d2cxkc4, d2cxkd3, d2cxkd4, d2cxke3, d2cxke4
    automated match to d2cxka1
    complexed with so4

Details for d2cxkc2

PDB Entry: 2cxk (more details), 1.85 Å

PDB Description: Crystal structure of the TIG domain of human calmodulin-binding transcription activator 1 (CAMTA1)
PDB Compounds: (C:) calmodulin binding transcription activator 1

SCOPe Domain Sequences for d2cxkc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cxkc2 b.1.18.1 (C:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]}
mvtdyspewsypeggvkvlitgpwqeasnnysclfdqisvpasliqpgvlrcycpahdtg
lvtlqvafnnqiisnsvvfeyk

SCOPe Domain Coordinates for d2cxkc2:

Click to download the PDB-style file with coordinates for d2cxkc2.
(The format of our PDB-style files is described here.)

Timeline for d2cxkc2: