Lineage for d2cxkb1 (2cxk B:872-953)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658572Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 658573Protein Calmodulin binding transcription activator 1 [141017] (1 species)
    this domain is in the middle of long protein chain
  7. 658574Species Human (Homo sapiens) [TaxId:9606] [141018] (1 PDB entry)
  8. 658576Domain d2cxkb1: 2cxk B:872-953 [131007]
    automatically matched to 2CXK A:872-953
    complexed with so4

Details for d2cxkb1

PDB Entry: 2cxk (more details), 1.85 Å

PDB Description: Crystal structure of the TIG domain of human calmodulin-binding transcription activator 1 (CAMTA1)
PDB Compounds: (B:) calmodulin binding transcription activator 1

SCOP Domain Sequences for d2cxkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cxkb1 b.1.18.1 (B:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]}
mvtdyspewsypeggvkvlitgpwqeasnnysclfdqisvpasliqpgvlrcycpahdtg
lvtlqvafnnqiisnsvvfeyk

SCOP Domain Coordinates for d2cxkb1:

Click to download the PDB-style file with coordinates for d2cxkb1.
(The format of our PDB-style files is described here.)

Timeline for d2cxkb1: