SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2cxkb2 (2cxk B:872-953)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2032115Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 protein domains)
    subgroup of the larger IPT/TIG domain family
  6. 2032116Protein Calmodulin binding transcription activator 1 [141017] (1 species)
    this domain is in the middle of long protein chain
  7. 2032117Species Human (Homo sapiens) [TaxId:9606] [141018] (1 PDB entry)
    Uniprot Q9Y6Y1 872-953
  8. 2032119Domain d2cxkb2: 2cxk B:872-953 [131007]
    Other proteins in same PDB: d2cxka2, d2cxka3, d2cxkb3, d2cxkb4, d2cxkc3, d2cxkc4, d2cxkd3, d2cxkd4, d2cxke3, d2cxke4
    automated match to d2cxka1
    complexed with so4

Details for d2cxkb2

PDB Entry: 2cxk (more details), 1.85 Å

PDB Description: Crystal structure of the TIG domain of human calmodulin-binding transcription activator 1 (CAMTA1)
PDB Compounds: (B:) calmodulin binding transcription activator 1

SCOPe Domain Sequences for d2cxkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cxkb2 b.1.18.1 (B:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]}
mvtdyspewsypeggvkvlitgpwqeasnnysclfdqisvpasliqpgvlrcycpahdtg
lvtlqvafnnqiisnsvvfeyk

SCOPe Domain Coordinates for d2cxkb2:

Click to download the PDB-style file with coordinates for d2cxkb2.
(The format of our PDB-style files is described here.)

Timeline for d2cxkb2: