Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins) subgroup of the larger IPT/TIG domain family |
Protein Calmodulin binding transcription activator 1 [141017] (1 species) this domain is in the middle of long protein chain |
Species Human (Homo sapiens) [TaxId:9606] [141018] (1 PDB entry) Uniprot Q9Y6Y1 872-953 |
Domain d2cxka1: 2cxk A:872-953 [131006] Other proteins in same PDB: d2cxka2, d2cxka3, d2cxkb3, d2cxkb4, d2cxkc3, d2cxkc4, d2cxkd3, d2cxkd4, d2cxke3, d2cxke4 complexed with so4 |
PDB Entry: 2cxk (more details), 1.85 Å
SCOPe Domain Sequences for d2cxka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} mvtdyspewsypeggvkvlitgpwqeasnnysclfdqisvpasliqpgvlrcycpahdtg lvtlqvafnnqiisnsvvfeyk
Timeline for d2cxka1: