Lineage for d2cxka1 (2cxk A:872-953)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 788951Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 788952Protein Calmodulin binding transcription activator 1 [141017] (1 species)
    this domain is in the middle of long protein chain
  7. 788953Species Human (Homo sapiens) [TaxId:9606] [141018] (1 PDB entry)
    Uniprot Q9Y6Y1 872-953
  8. 788954Domain d2cxka1: 2cxk A:872-953 [131006]
    complexed with so4

Details for d2cxka1

PDB Entry: 2cxk (more details), 1.85 Å

PDB Description: Crystal structure of the TIG domain of human calmodulin-binding transcription activator 1 (CAMTA1)
PDB Compounds: (A:) calmodulin binding transcription activator 1

SCOP Domain Sequences for d2cxka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]}
mvtdyspewsypeggvkvlitgpwqeasnnysclfdqisvpasliqpgvlrcycpahdtg
lvtlqvafnnqiisnsvvfeyk

SCOP Domain Coordinates for d2cxka1:

Click to download the PDB-style file with coordinates for d2cxka1.
(The format of our PDB-style files is described here.)

Timeline for d2cxka1: