SCOPe 2.01: Domain d2cxha1: 2cxh A:13-192

Lineage for d2cxha1 (2cxh A:13-192)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families)

5. Family c.51.1.2: Brix domain [142420] (1 protein)
   Pfam PF04427; tandem repeat of two ABD-like structural repeats, which are associated together with the formation of single beta-sheet, folded into half-barrel

6. Protein Probable ribosomal biogenesis protein [142421] (2 species)
   comprises stand-alone brix domain

7. Species Aeropyrum pernix [TaxId:56636] [142423] (1 PDB entry)
   Uniprot Q9YC08 13-192
   APE1443

8. Domain d2cxha1: 2cxh A:13-192 [131005]

Details for d2cxha1

PDB Entry: 2cxh, 1.8 Å

PDB Description: Crystal structure of probable ribosomal biogenesis protein from Aeropyrum pernix K1

PDB Compounds: (A:) Probable brix-domain ribosomal biogenesis protein

SCOPe Domain Sequences for d2cxha1:

Sequence; same for both SEQRES and ATOM records:

>d2cxha1 c.51.1.2 (A:13-192) Probable ribosomal biogenesis protein {Aeropyrum pernix [TaxId: 56636]}
gyrilvttsrrpsprirsfvkdlsatipgafrftrghysmeelareaiirgadrivvvge
rrgnpgiirvyavegperpdnivsfivkgvslsrerrwglpslrggevlvarpldsgvav
efadafviafharlkppeaagyveaviesldartvavtfryggapvgpmlrlgkpaemvk

Timeline for d2cxha1:

• d2cxha1 first appeared in SCOP 1.73
  
• d2cxha1 appears in SCOP 1.75
  
• d2cxha1 appears in SCOPe 2.02
  
• d2cxha1 appears in the current release, SCOPe 2.08