SCOPe 2.05: Domain d2cxfa1: 2cxf A:83-249

Lineage for d2cxfa1 (2cxf A:83-249)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.256: RUN domain-like [140740] (1 superfamily)
   multihelical; 3-helical bundle similar to one half of the DEATH domain fold is flanked by two alpha-hairpins forming a four-helical bundle; the axes of the three-helical and four-helical bundles are aproximately orthogonal to each other

4. Superfamily a.256.1: RUN domain-like [140741] (1 family)

5. Family a.256.1.1: RUN domain [140742] (2 proteins)
   Pfam PF02759

6. Protein Rap2 interacting protein X (RUFY3) [140743] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140744] (2 PDB entries)
   Uniprot Q9D394 65-231

8. Domain d2cxfa1: 2cxf A:83-249 [131004]

Details for d2cxfa1

PDB Entry: 2cxf, 3.07 Å

PDB Description: RUN domain of Rap2 interacting protein x, crystallized in C2 space group

PDB Compounds: (A:) rap2 interacting protein x

SCOPe Domain Sequences for d2cxfa1:

Sequence; same for both SEQRES and ATOM records:

>d2cxfa1 a.256.1.1 (A:83-249) Rap2 interacting protein X (RUFY3) {Mouse (Mus musculus) [TaxId: 10090]}
manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkakktflg
qnksfwgplelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkali
nkkellsefyevnalmmeeegaiiagllvglnvidanfcmkgedlds

Timeline for d2cxfa1:

• d2cxfa1 first appeared in SCOP 1.73
  
• d2cxfa1 appears in SCOPe 2.04
  
• d2cxfa1 appears in SCOPe 2.06
  
• d2cxfa1 appears in the current release, SCOPe 2.08