SCOPe 2.03: Domain d2cxec2: 2cxe C:9-133

Lineage for d2cxec2 (2cxe C:9-133)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143363] (3 PDB entries)
   Uniprot O58677 8-133

8. Domain d2cxec2: 2cxe C:9-133 [131001]
   Other proteins in same PDB: d2cxea1, d2cxeb1, d2cxec1, d2cxed1
   automatically matched to 2CWX A:8-133

Details for d2cxec2

PDB Entry: 2cxe, 3 Å

PDB Description: Crystal structure of octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-2 crystal)

PDB Compounds: (C:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d2cxec2:

Sequence; same for both SEQRES and ATOM records:

>d2cxec2 d.58.9.1 (C:9-133) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Pyrococcus horikoshii [TaxId: 53953]}
ewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakrs
makvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppye
ylrhf

Timeline for d2cxec2:

• d2cxec2 first appeared in SCOP 1.73
  
• d2cxec2 appears in SCOPe 2.02
  
• d2cxec2 appears in SCOPe 2.04
  
• d2cxec2 appears in the current release, SCOPe 2.08