![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
![]() | Protein automated matches [226983] (27 species) not a true protein |
![]() | Species Pyrococcus horikoshii OT3 [TaxId:70601] [255097] (1 PDB entry) |
![]() | Domain d2cxeb2: 2cxe B:9-132 [130999] Other proteins in same PDB: d2cxea1, d2cxeb1, d2cxec1, d2cxed1 automated match to d1ej7l2 |
PDB Entry: 2cxe (more details), 3 Å
SCOPe Domain Sequences for d2cxeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cxeb2 d.58.9.0 (B:9-132) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} ewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakrs makvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppye ylrh
Timeline for d2cxeb2: