![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) ![]() |
![]() | Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein) N-terminal domain is alpha+beta |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species) |
![]() | Species Archaeon Pyrococcus horikoshii [TaxId:53953] [141850] (3 PDB entries) Uniprot O58677 134-424 |
![]() | Domain d2cxeb1: 2cxe B:134-424 [130998] Other proteins in same PDB: d2cxea2, d2cxeb2, d2cxec2, d2cxed2 automatically matched to 2CWX A:134-424 |
PDB Entry: 2cxe (more details), 3 Å
SCOP Domain Sequences for d2cxeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cxeb1 c.1.14.1 (B:134-424) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} kgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsggidllkddenfts fpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraemvaneggqyvmidi vvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalakaarmigvdqihtg tavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpelirlfgkdlviqagg gvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevglska
Timeline for d2cxeb1: