SCOP 1.73: Domain d2cxeb1: 2cxe B:134-424

Lineage for d2cxeb1 (2cxe B:134-424)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family)

5. Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
   N-terminal domain is alpha+beta

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [141850] (3 PDB entries)

8. Domain d2cxeb1: 2cxe B:134-424 [130998]
   Other proteins in same PDB: d2cxea2, d2cxeb2, d2cxec2, d2cxed2
   automatically matched to 2CWX A:134-424

Details for d2cxeb1

PDB Entry: 2cxe, 3 Å

PDB Description: Crystal structure of octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-2 crystal)

PDB Compounds: (B:) Ribulose bisphosphate carboxylase

SCOP Domain Sequences for d2cxeb1:

Sequence; same for both SEQRES and ATOM records:

>d2cxeb1 c.1.14.1 (B:134-424) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
kgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsggidllkddenfts
fpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraemvaneggqyvmidi
vvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalakaarmigvdqihtg
tavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpelirlfgkdlviqagg
gvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevglska

Timeline for d2cxeb1:

• d2cxeb1 is new in SCOP 1.73
  
• d2cxeb1 appears in SCOP 1.75
  
• d2cxeb1 appears in the current release, SCOPe 2.08