![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) ![]() automatically mapped to Pfam PF00016 |
![]() | Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins) N-terminal domain is alpha+beta |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [141850] (3 PDB entries) Uniprot O58677 134-424 |
![]() | Domain d2cxea1: 2cxe A:133-424 [130996] Other proteins in same PDB: d2cxea2, d2cxeb2, d2cxec2, d2cxed2 |
PDB Entry: 2cxe (more details), 3 Å
SCOPe Domain Sequences for d2cxea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cxea1 c.1.14.1 (A:133-424) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Pyrococcus horikoshii [TaxId: 53953]} fkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsggidllkddenft sfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraemvaneggqyvmid ivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalakaarmigvdqiht gtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpelirlfgkdlviqag ggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevglska
Timeline for d2cxea1: