SCOP 1.73: Domain d2cxdb1: 2cxd B:1-94

Lineage for d2cxdb1 (2cxd B:1-94)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (2 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.2: TTHA0068-like [140663] (1 family)

5. Family a.246.2.1: TTHA0068-like [140664] (2 proteins)
   Pfam PF03745; DUF309

6. Protein Hypothetical protein TTHA0068 [140667] (1 species)

7. Species Thermus thermophilus [TaxId:274] [140668] (2 PDB entries)

8. Domain d2cxdb1: 2cxd B:1-94 [130995]
   automatically matched to 2CWY A:1-94

Details for d2cxdb1

PDB Entry: 2cxd, 2 Å

PDB Description: Crystal structure of conserved hypothetical protein, TTHA0068 from Thermus thermophilus HB8

PDB Compounds: (B:) conserved hypothetical protein, TTHA0068

SCOP Domain Sequences for d2cxdb1:

Sequence; same for both SEQRES and ATOM records:

>d2cxdb1 a.246.2.1 (B:1-94) Hypothetical protein TTHA0068 {Thermus thermophilus [TaxId: 274]}
mvpdweevlglwragryyevhevlepywlkatgeerrllqgvillaaalhqrrlgrpglr
nlrkaearleglpcplmgldwrsllqearrrlga

Timeline for d2cxdb1:

• d2cxdb1 is new in SCOP 1.73
  
• d2cxdb1 appears in SCOP 1.75
  
• d2cxdb1 appears in the current release, SCOPe 2.08, called d2cxdb_