Lineage for d2cxaa1 (2cxa A:1-232)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533710Family d.108.1.6: LFTR-like [143711] (2 proteins)
    Pfam PF03588; closer relative to the nonribosomal peptidyltransferases (82749); deletion of the N-terminal half of the N-terminal NAT-like domain after the domain duplication/swapping events
  6. 2533711Protein Leucyl/phenylalanyl-tRNA-protein transferase, LFTR (Aat) [143712] (1 species)
  7. 2533712Species Escherichia coli [TaxId:562] [143713] (7 PDB entries)
    Uniprot P0A8P1 1-232
  8. 2533713Domain d2cxaa1: 2cxa A:1-232 [130993]

Details for d2cxaa1

PDB Entry: 2cxa (more details), 1.6 Å

PDB Description: Crystal structure of Leucyl/phenylalanyl-tRNA protein transferase from Escherichia coli
PDB Compounds: (A:) Leucyl/phenylalanyl-tRNA-protein transferase

SCOPe Domain Sequences for d2cxaa1:

Sequence, based on SEQRES records: (download)

>d2cxaa1 d.108.1.6 (A:1-232) Leucyl/phenylalanyl-tRNA-protein transferase, LFTR (Aat) {Escherichia coli [TaxId: 562]}
mrlvqlsrhsiafpspegalrepngllalggdlsparllmayqrgifpwfspgdpilwws
pdpravlwpeslhisrsmkrfhkrspyrvtmnyafgqviegcasdreegtwitrgvveay
hrlhelghahsievwredelvggmygvaqgtlfcgesmfsrmenasktallvfceefigh
ggklidcqvlndhtaslgaceiprrdylnylnqmrlgrlpnnfwvprclfsp

Sequence, based on observed residues (ATOM records): (download)

>d2cxaa1 d.108.1.6 (A:1-232) Leucyl/phenylalanyl-tRNA-protein transferase, LFTR (Aat) {Escherichia coli [TaxId: 562]}
mrlvqlsrhsiafpspegalrepngllalggdlsparllmayqrgifpwfspgdpilwws
pdpravlwpeslhisrsmkrfhkrspyrvtmnyafgqviegcasdgtwitrgvveayhrl
helghahsievwredelvggmygvaqgtlfcgesmfsrmenasktallvfceefighggk
lidcqvlndhtaslgaceiprrdylnylnqmrlgrlpnnfwvprclfsp

SCOPe Domain Coordinates for d2cxaa1:

Click to download the PDB-style file with coordinates for d2cxaa1.
(The format of our PDB-style files is described here.)

Timeline for d2cxaa1: