Lineage for d2cx9d2 (2cx9 D:3-234)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 742756Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 742757Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 742758Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (9 proteins)
  6. 742765Protein Acyl-CoA dehydrogenase [144024] (1 species)
  7. 742766Species Thermus thermophilus [TaxId:274] [144025] (3 PDB entries)
  8. 742772Domain d2cx9d2: 2cx9 D:3-234 [130992]
    Other proteins in same PDB: d2cx9a1, d2cx9b1, d2cx9c1, d2cx9d1
    automatically matched to 1WS9 A:2-234
    complexed with cl

Details for d2cx9d2

PDB Entry: 2cx9 (more details), 2 Å

PDB Description: crystal structure of acyl-coa dehydrogenase
PDB Compounds: (D:) acyl-CoA dehydrogenase

SCOP Domain Sequences for d2cx9d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cx9d2 e.6.1.1 (D:3-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]}
lwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpeayg
gaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasgeal
gawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppsper
khqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallger

SCOP Domain Coordinates for d2cx9d2:

Click to download the PDB-style file with coordinates for d2cx9d2.
(The format of our PDB-style files is described here.)

Timeline for d2cx9d2: