SCOPe 2.06: Domain d2cx9c2: 2cx9 C:3-234

Lineage for d2cx9c2 (2cx9 C:3-234)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)

6. Protein Acyl-CoA dehydrogenase [144024] (1 species)

7. Species Thermus thermophilus [TaxId:274] [144025] (3 PDB entries)
   Uniprot Q5SGZ2 2-234

8. Domain d2cx9c2: 2cx9 C:3-234 [130990]
   Other proteins in same PDB: d2cx9a1, d2cx9b1, d2cx9c1, d2cx9d1
   automated match to d1ws9a2
   complexed with cl

Details for d2cx9c2

PDB Entry: 2cx9, 2 Å

PDB Description: crystal structure of acyl-coa dehydrogenase

PDB Compounds: (C:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d2cx9c2:

Sequence; same for both SEQRES and ATOM records:

>d2cx9c2 e.6.1.1 (C:3-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]}
lwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpeayg
gaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasgeal
gawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppsper
khqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallger

Timeline for d2cx9c2:

• d2cx9c2 first appeared in SCOP 1.73
  
• d2cx9c2 appears in SCOPe 2.05
  
• d2cx9c2 appears in SCOPe 2.07
  
• d2cx9c2 appears in the current release, SCOPe 2.08