SCOPe 2.05: Domain d2cx9c1: 2cx9 C:235-387

Lineage for d2cx9c1 (2cx9 C:235-387)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)

6. Protein Acyl-CoA dehydrogenase [140473] (1 species)

7. Species Thermus thermophilus [TaxId:274] [140474] (3 PDB entries)
   Uniprot Q5SGZ2 235-387

8. Domain d2cx9c1: 2cx9 C:235-387 [130989]
   Other proteins in same PDB: d2cx9a2, d2cx9b2, d2cx9c2, d2cx9d2
   automated match to d1ws9a1
   complexed with cl

Details for d2cx9c1

PDB Entry: 2cx9, 2 Å

PDB Description: crystal structure of acyl-coa dehydrogenase

PDB Compounds: (C:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d2cx9c1:

Sequence; same for both SEQRES and ATOM records:

>d2cx9c1 a.29.3.1 (C:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]}
gkgfydvlrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaea
ateleaarllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdyp
verywrdarltrigegtseilklviarrlleav

Timeline for d2cx9c1:

• d2cx9c1 first appeared in SCOP 1.73
  
• d2cx9c1 appears in SCOPe 2.04
  
• d2cx9c1 appears in SCOPe 2.06
  
• d2cx9c1 appears in the current release, SCOPe 2.08