SCOP 1.73: Domain d2cx9b1: 2cx9 B:235-387

Lineage for d2cx9b1 (2cx9 B:235-387)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.29: Bromodomain-like [47363] (10 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 proteins)

6. Protein Acyl-CoA dehydrogenase [140473] (1 species)

7. Species Thermus thermophilus [TaxId:274] [140474] (3 PDB entries)

8. Domain d2cx9b1: 2cx9 B:235-387 [130987]
   Other proteins in same PDB: d2cx9a2, d2cx9b2, d2cx9c2, d2cx9d2
   automatically matched to 1WS9 A:235-387
   complexed with cl

Details for d2cx9b1

PDB Entry: 2cx9, 2 Å

PDB Description: crystal structure of acyl-coa dehydrogenase

PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOP Domain Sequences for d2cx9b1:

Sequence; same for both SEQRES and ATOM records:

>d2cx9b1 a.29.3.1 (B:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]}
gkgfydvlrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaea
ateleaarllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdyp
verywrdarltrigegtseilklviarrlleav

Timeline for d2cx9b1:

• d2cx9b1 is new in SCOP 1.73
  
• d2cx9b1 appears in SCOP 1.75
  
• d2cx9b1 appears in the current release, SCOPe 2.08