![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
![]() | Superfamily c.116.1: alpha/beta knot [75217] (9 families) ![]() known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
![]() | Family c.116.1.5: YggJ C-terminal domain-like [89632] (4 proteins) contains extra strand (3) in the parallel beta-sheet, order 321546; similar dimerisation to the MTH1 domain |
![]() | Protein Hypothetical protein TTHA0657 (TT1575) [117494] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [117495] (3 PDB entries) Uniprot Q5SKI6 |
![]() | Domain d2cx8a2: 2cx8 A:67-228 [130984] Other proteins in same PDB: d2cx8a1 complexed with sah |
PDB Entry: 2cx8 (more details), 2.53 Å
SCOPe Domain Sequences for d2cx8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cx8a2 c.116.1.5 (A:67-228) Hypothetical protein TTHA0657 (TT1575) {Thermus thermophilus [TaxId: 274]} revgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrrlraval eaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpekplalavgpeggf aeeevalleargftpvslgrrilraetaalallalctagegr
Timeline for d2cx8a2: