Lineage for d2cx8a2 (2cx8 A:67-228)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921365Family c.116.1.5: YggJ C-terminal domain-like [89632] (4 proteins)
    contains extra strand (3) in the parallel beta-sheet, order 321546; similar dimerisation to the MTH1 domain
  6. 2921372Protein Hypothetical protein TTHA0657 (TT1575) [117494] (1 species)
  7. 2921373Species Thermus thermophilus [TaxId:274] [117495] (3 PDB entries)
    Uniprot Q5SKI6
  8. 2921376Domain d2cx8a2: 2cx8 A:67-228 [130984]
    Other proteins in same PDB: d2cx8a1
    complexed with sah

Details for d2cx8a2

PDB Entry: 2cx8 (more details), 2.53 Å

PDB Description: Crystal structure of methyltransferase with ligand(SAH)
PDB Compounds: (A:) methyl transferase

SCOPe Domain Sequences for d2cx8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cx8a2 c.116.1.5 (A:67-228) Hypothetical protein TTHA0657 (TT1575) {Thermus thermophilus [TaxId: 274]}
revgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrrlraval
eaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpekplalavgpeggf
aeeevalleargftpvslgrrilraetaalallalctagegr

SCOPe Domain Coordinates for d2cx8a2:

Click to download the PDB-style file with coordinates for d2cx8a2.
(The format of our PDB-style files is described here.)

Timeline for d2cx8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cx8a1
View in 3D
Domains from other chains:
(mouse over for more information)
d2cx8b1