SCOP 1.75: Domain d2cx6a1: 2cx6 A:1-90

Lineage for d2cx6a1 (2cx6 A:1-90)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.1: Barstar-related [52038] (1 family)

5. Family c.9.1.1: Barstar-related [52039] (2 proteins)

6. Protein Hypothetical protein YhcO [141990] (1 species)

7. Species Escherichia coli [TaxId:562] [141991] (1 PDB entry)
   Uniprot P64618 1-90

8. Domain d2cx6a1: 2cx6 A:1-90 [130981]

Details for d2cx6a1

PDB Entry: 2cx6, 2.43 Å

PDB Description: Crystal structure of ribonuclease inhibitor Barstar

PDB Compounds: (A:) Hypothetical protein yhcO

SCOP Domain Sequences for d2cx6a1:

Sequence; same for both SEQRES and ATOM records:

>d2cx6a1 c.9.1.1 (A:1-90) Hypothetical protein YhcO {Escherichia coli [TaxId: 562]}
mniytfdfdeiesqedfyrdfsqtfglakdkvrdldslwdvlmndvlplpleiefvhlge
ktrrrfgalillfdeaeeeleghlrfnvrh

Timeline for d2cx6a1:

• d2cx6a1 first appeared in SCOP 1.73
  
• d2cx6a1 appears in SCOPe 2.01
  
• d2cx6a1 appears in the current release, SCOPe 2.08