Lineage for d2cx4h1 (2cx4 H:4-163)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699806Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)
  6. 699881Protein Bacterioferritin comigratory protein [142377] (1 species)
  7. 699882Species Archaeon Aeropyrum pernix [TaxId:56636] [142378] (2 PDB entries)
  8. 699890Domain d2cx4h1: 2cx4 H:4-163 [130980]
    automatically matched to 2CX3 A:4-163

Details for d2cx4h1

PDB Entry: 2cx4 (more details), 2.3 Å

PDB Description: Crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the Aeropyrum pernix K1 (form-2 crystal)
PDB Compounds: (H:) bacterioferritin comigratory protein

SCOP Domain Sequences for d2cx4h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cx4h1 c.47.1.10 (H:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]}
lvelgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaql
ekanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakra
vfivkpdgtvaykwvtdnplnepdydevvreankiagelv

SCOP Domain Coordinates for d2cx4h1:

Click to download the PDB-style file with coordinates for d2cx4h1.
(The format of our PDB-style files is described here.)

Timeline for d2cx4h1: