SCOP 1.73: Domain d2cx4f1: 2cx4 F:4-163

Lineage for d2cx4f1 (2cx4 F:4-163)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)

6. Protein Bacterioferritin comigratory protein [142377] (1 species)

7. Species Archaeon Aeropyrum pernix [TaxId:56636] [142378] (2 PDB entries)

8. Domain d2cx4f1: 2cx4 F:4-163 [130978]
   automatically matched to 2CX3 A:4-163

Details for d2cx4f1

PDB Entry: 2cx4, 2.3 Å

PDB Description: Crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the Aeropyrum pernix K1 (form-2 crystal)

PDB Compounds: (F:) bacterioferritin comigratory protein

SCOP Domain Sequences for d2cx4f1:

Sequence; same for both SEQRES and ATOM records:

>d2cx4f1 c.47.1.10 (F:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]}
lvelgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaql
ekanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakra
vfivkpdgtvaykwvtdnplnepdydevvreankiagelv

Timeline for d2cx4f1:

• d2cx4f1 is new in SCOP 1.73
  
• d2cx4f1 appears in SCOP 1.75
  
• d2cx4f1 appears in the current release, SCOPe 2.08, called d2cx4f2