![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (22 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins) |
![]() | Protein Bacterioferritin comigratory protein [142377] (1 species) |
![]() | Species Archaeon Aeropyrum pernix [TaxId:56636] [142378] (2 PDB entries) |
![]() | Domain d2cx4e1: 2cx4 E:4-163 [130977] automatically matched to 2CX3 A:4-163 |
PDB Entry: 2cx4 (more details), 2.3 Å
SCOP Domain Sequences for d2cx4e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cx4e1 c.47.1.10 (E:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} lvelgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaql ekanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakra vfivkpdgtvaykwvtdnplnepdydevvreankiagelv
Timeline for d2cx4e1: