Lineage for d2cx4e2 (2cx4 E:5-163)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877586Protein Bacterioferritin comigratory protein [142377] (1 species)
  7. 2877587Species Aeropyrum pernix [TaxId:56636] [142378] (4 PDB entries)
    Uniprot Q9YA14 4-163
  8. 2877598Domain d2cx4e2: 2cx4 E:5-163 [130977]
    Other proteins in same PDB: d2cx4a3, d2cx4b3, d2cx4c3, d2cx4d3, d2cx4e3, d2cx4f3, d2cx4g3, d2cx4h3
    automated match to d2cx3a1

Details for d2cx4e2

PDB Entry: 2cx4 (more details), 2.3 Å

PDB Description: Crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the Aeropyrum pernix K1 (form-2 crystal)
PDB Compounds: (E:) bacterioferritin comigratory protein

SCOPe Domain Sequences for d2cx4e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cx4e2 c.47.1.10 (E:5-163) Bacterioferritin comigratory protein {Aeropyrum pernix [TaxId: 56636]}
velgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaqle
kanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakrav
fivkpdgtvaykwvtdnplnepdydevvreankiagelv

SCOPe Domain Coordinates for d2cx4e2:

Click to download the PDB-style file with coordinates for d2cx4e2.
(The format of our PDB-style files is described here.)

Timeline for d2cx4e2: